Scientific and Technical Journal

ELECTROTECHNIC AND COMPUTER SYSTEMS

ISSN Print 2221-3937
ISSN Online 2221-3805
METHODOLOGY OF TEMPLATES TESTING AUTOMATION ON BASE OF CONTROL SOFTWARE SYSTEM OF THEIR QUALITY
Abstract:

Software system quality control of templates is offered and methodology of automation testing of current system is developed. Software systems has a high noise immunity significatives,  that provides an opportunity to  reduce the requirements to it hardware performance. This allow resolve the contradiction  between high cost  of control and necessity development of small and medium batches of microelectronic products. Execution of experiments on large amounts of data by manual way has led to an increase in the time that spent on testing the system. Proposed to automate this process. Software complex QuickTest Professional  as the automated  tool was selected.  It allows to developing automatic tests for application, that based on using of various modern technology of developing software products and includes the usable instrument of  data parameterization.   Using of Data Table object during the developing of automatic script allowed to parameterize of input values for the implementation iterative of data-in. The analysis of test results is executed. The positive estimates of iterations passage is obtained. Applying of automation testing   methodology of software system  allowed to reduce of testing time in compare with manual method.

Authors:
Keywords
DOI
10.15276/etks.13.89.2014.12
References
  1. GotraZ.Yu. Technologiya micro-electronnih ustroistv[Microelectronic Devices Ttechnology], (1991), Radio i svyaz Publ., Moskow, Russian Federation, 527 p. (In Russian).
  2. Grachev A. A., Melnik A.A., and Panov L. I. Poverhnostnie montag pri construirovanii i proizvodstve electronnoi apparaturi [Surface Mount Designwiththe Manufacture of Electronic Equipment], (2003), ONUA Publ., Odessa, Ukraine,427 p. (In Russian).
  3. GonsalesR.,and Vuds R.Cifrovayaobrabotkaizobragenie [Digital Image Processing], (2005), Technosfera Publ., Moskow, Russian Federation,  1072 p. (In Russian). 
  4. KrylovV.N., ScherbacovaG. Yu., andKozinaYu.Yu.  Pozicionirovanie izobragenie fotoshablonov v sistemah avtomatizirovanogo opticheskogo kontrolya [Positionin of Photomasks Images in Automated Optical Inspection Systems], (2007), Technologiya i Construirovanie v Electronnoi Apparature Publ., Odessa, Ukraine, Vol. 3 (69), pp. 61 – 64 (In Russian), url: http://dspace.nbuv.gov.ua/bitstream/handle/123456789/52819/16-Krylov.pdf?sequence=1.
  5.  KrylovV.N., ScherbacovaG. Yu., KozinaYu. Yu., andVoloshinV.V. Pomehoustoichivayaclassificaciya  repernihznakovvprostranstvegiperbolicheskogoveivletpreobrazovaniya [NoiseImmunity ClassificationofFiducialsinHyperbolicWaveletTransformationSpace], (2007), SistemniTechnologii. Regionalnie Migvuzivskie Sbornik Naukovih Prac. Publ., Dnepropetrovsk, Ukraine, Vol. 6 (53), pp. 125 – 130 (In Russian).
  6. KozinaYu.Yu. Pomehoustoichivayaclassifikaciyarepernihznakovsobucheniemmnogosloinohoperseptronavprostranstve  giperbolicheskogoveivletpreobrazovaniya [NoiseImmunity ClassificationofFiducialswithTrainingofMultilayerPerceptroninHyperbolicWaveletTransformationSpace], (2009), SbirnikNaukovihPracViskovogoInstituteImeniTarasaShevchenkoPubl., Kiev, Ukraine, Vol. 21, pp. 106 – 109 (InRussian). url: http://www.mil.univ.kiev.ua/files/77_186944991.pdf.
  1. KozinaYu.Yu. Zastosuvanyacilochiselnoioptimizaciidlyaclassifikaciiobrazivrepernihznakov [ApplyingofIntegerOptimizationforPatternClassificationofFiducials], (2012), PraciOdesskogoPolitehnichnogoUniversitetuPubl., Odessa, Ukraine, Vol 1(38), pp. 142 – 148 (InUkraine). url: http://pratsi.opu.ua/app/webroot/articles/1346847014.pdf.
  1. Kozina Yu.Yu. Povishenie pomehoustoichivosti proceduri classifikacii pri kontrole kachestva shablonov [Increasing Noise Immunity Procedure Classification for Quality Control of Templates], (2012), Informatica ta Matematichni Metodi v Modelyuvanni Publ., Odessa, Ukraine, Vol. T.2 (2), pp.121 –129 (In Russian). url: http://immm.opu.ua/files/archive/n2_v2_2012/n2_v2_2012.pdf.
  1. DastinE., andReshkaD. Avtomatizirovanoetestirovanieprogramnogoobespecheniya [AutomationSoftwareTesting], (2003),  Lori Publ., Moskow, RussianFederation, 256 p. (InRussian).
  2. Black R. Klyuchenie processi testirovaniya. Planirovanie, podgotovka, provedenie, sovershenstvovanie [Main Processing of Testing. Planning, Preperation, Execution, Improving], (2006), Lori  Publ., Moskow, Russian Federation, 125 p. (In Russian).
Published:
Last download:
2017-11-16 11:39:54

[ © KarelWintersky ] [ All articles ] [ All authors ]
[ © Odessa National Polytechnic University, 2014. Any use of information from the site is possible only under the condition that the source link! ]
Яндекс.Метрика